<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14249 CA34414 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 101

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV N348I     R83K, I135IL, E138EA, I142IT, K166KR, T200TA, R211K, A272P, K277R, R284K, A288G, T290A, E291K, P294A, E297A, K311R, Q334L, M357T, I375V, T386V, A400T, D460N L289R
>CA34414| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNATPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLKGTKGRAKVIALTAEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKILKTGKYARTRGA
HTNDVKQLTEAVQKVATESIVIWGKVPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36MI, N37D, V77VI  
>CA33399| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005