<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5433 CA34379 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 291

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75T, Q151M, M184V K219E     I5IV, K11KR, K20KR, A33V, S68G, V111I, I142V, S162Y, E203D, R211RK, F214L, V245E, D250DE, V292I, I293V  
>CA34379| codons 1-300
PISPVETVPVRLKPGMDGPRVKQWPLTEEKIKVLVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRQHLLKWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10F, L24I, K43KT I15V, R41RK, K55R, I62V, L63P, A71V, I72IT, V77I  
>CA33364| codons 1-99
PQITLWQRPFVTIKVGGQLKEALIDTGADDTVLEEMNLPGKWTPKLIGGIGGFVRVRQYD
QVPIEICGHKVTGTVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005