<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4061 CA34375 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDC 52
3 3TC+AZT+SQV 30
4 3TC+AZT+IDV 43
5 DDI+NFV+NVP 26
6 3TC 74
7 3TC+EFV+IDV+RTV 143

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210W T215C K101E, Y181C, G190A   K20R, K49R, I50V, T69TS, R83K, D121Y, K122E, I135V, R211K, P243T, V245K, D250E, A272P, I293V, E297R  
>CA34375| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRVGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQTIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTREAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, I13IV, E35D, M36I, R57K, D60E, Q61E, I62V, L63P, A71V, I72R, I85IV  
>CA33360| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYE
EVPIEICGHKVRSTVLVGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005