<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14205 CA34336 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 65
2 3TC+D4T+NFV 158

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V N348I     K122P, I142IV, S162SN, L210F, R211K, K277R, E291D, A327V, I341IF, M357T, E370G, K390R, E404D, V435A, L452S, D460N, R461K, L469I, L491P, Q509H, S519N, Q524E  
>CA34336| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLFKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTDVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGQGQWTYQFYQEPFKILKTGKYARTRGA
HTNDVKQLTGAVQKIATESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKSGKAGYVTNKGRQKVVSITDTTNQKTELQ
AIHLALQDSGPEVNIVTDSQYALGIIQAHPDKSESELVNQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18L, E35D, M36I, N37E, D60E, L63PT, I64V, I93IL  
>CA33321| codons 1-99
PQITLWQRPLVTIKIGGLLKEALLDTGADDTVLEDIELPGRWKPKMIGGIGGFIKVRQYE
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005