<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14196 CA34323 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 100
2 3TC+ABC+AZT+NFV 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, M184V, T215FS K219E     V35I, T39S, R83K, D121HY, K122E, I135T, G196E, F214FL, A272P, K275R, R284K, T286A, I293V, P294T, Q334E, M357T, Q373H, A400T, E404D, D460N, R461K, V467I, H483N, L491S, K512Q, S519N, Q547R, A554S, V559I E370M
>CA34323| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICSEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLSTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLKGAKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTMAVHKIATESIVIWGKTPKFKLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVISLTDTTNQKTELQ
AINLALQDSGSEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNERVDKLVSSGIRKIL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN N88ND L10I, T12Q, I13V, K14R, E35D, M36MI, N37S, R41K, Q61E, I62V, L63P, I64V, C67Y, A71AT  
>CA33308| codons 1-99
PQITLWQRPIVQVRIGGQLKEALLDTGADNTVLEDISLPGKWKPKMIGGIGGFIKVRQYD
EVPVEIYGHKTIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005