<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14185 CA34309 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 None 104
3 3TC+D4T 26
4 D4T+DDC+IDV 39
5 3TC+D4T+IDV 183
6 3TC+D4T+NFV 57

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V T215D, K219KR     K20R, I135V, S162C, Q174H, V179T, T200A, Q207E, V245K  
>CA34309| codons 1-295
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKHNPDITI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFDTPDRKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88ND R41K, R57K, I62V, L63P, A71T, V77I, I93L  
>CA33294| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGKWKPKMIGGIGGFIKVKQYD
QVPIEICGHKTIGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009