<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5391 CA34303 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 178
2 D4T+IDV 52
3 DDI+NFV 30
4 3TC+NFV+AZT 60
5 D4T+NFV+3TC 43
6 3TC+AZT+LPV 43
7 ABC+EFV+3TC 12
8 3TC+D4T+NFV 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y D67G, K219N Y181C   K43KQ, S68G, R83K, V118I, K166R, E169K, K173E, Q207E, R211K, D218E, A272P, K277R, T286A  
>CA34303| codons 1-292
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKGGTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILKPFREQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPENKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82F, L90M   I13IV, I15V, K20M, E35D, M36V, R41K, I62V, L63P, T74S, I93L  
>CA33286| codons 1-99
PQITLWQRPLVTVKVGGQLMEALLDTGADDTVLEDVNLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGHKAIGSVLVGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005