<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14174 CA34296 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 9
2 3TC+D4T+NVP 63

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219E Y181C, G190A   V35T, K43N, E44X, V118I, D123E, I135T, S162SN, E203EK, R211K, L228H, A272P, V292I, E297R  
>CA34296| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELENXGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIKELRQHLWKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIIPLTREAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M   L10I, E35D, M36I, N37D, D60E, L63P, I64V, L89LM, I93IL  
>CA33280| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYE
QIPVEICGHKAIGTVLVGPTPVNIIGRNMMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005