<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1506 CA34254 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDC 553

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M       V35VA, T39A, T69X, K102Q, A158AS, S162A, T165I, I167IV, G196K, L228H, S251N, K277R, L283LI, I293V, E297A V111L
>CA34254| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALAEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSXKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDLGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPSIFQASMIKVLEPFRKQNPDIVI
YQYMDDLYVGSDLEIKQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDNWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLIRGTKALTEVVPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, L63P  
>CA33239| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005