<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9915 CA34249 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 23
2 3TC+AZT 62
3 3TC+D4T+NFV 55
4 None 22
5 3TC+ABC+AZT 41
6 3TC+D4T+EFV 147

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, G16E, N37T, R41K, I62V, L63T, I64L, I72T, V77I  
>CA34249| codons 1-99
PQITLWQRPLVTIRIEGQLKEALLDTGADDTVLEEMTLPGKWKPKMIGGIGGFIKVRQYD
QVTLEICGHKATGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q G190A V179D K20KR, V35T, V60I, K103R, I135L, Q174E, T200A, V245M, A272T, T286A, I293V  
>CA35264| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPDIDI
YQYVDDLYVASDLEIGQHRAKIEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGAKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005