<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4797 CA34242 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 None 57
3 3TC+IDV 22
4 3TC+AZT+IDV 270
5 D4T+NVP+RTV+SQV 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82F, L90M G48GE, I84IL L10I, L19Q, K20I, F53FY, K55KT, L63P, I64V, H69HR, A71V, I72T, V77I, I85V, I93L  
>CA34242| codons 1-99
PQITLWQRPIVTIKIGGQQIEALLDTGADDTVLEEMNLPGRWKPKLIEGIGGYVTVRQYD
QIPVEICGRKVTGTVLIGPTPFNLVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y   K103N, Y181C   K20R, K43Q, E44D, V118I, K122E, T200TI, E203ED, Q207AD, R211K, V245M, E248D, D250E, R284K, I293V, D324E, G335S, M357T, G359S, V365VI, K390R, A400T, V435E, A437V, A446S, H483Y, L491S, E529D, Q547H, V559I T286R
>CA35258| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRIKIDELRDHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGRKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQSQWTYQIYQEPFKNLKTGKYARTRSA
HTNDIKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGVETFYVDGASNRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKDKVYLAWVPAHK
GIGGNEHVDKLVSAGIRKIL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009