<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1592 CA34241 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+IDV+RTV 8
2 3TC+AZT 103
3 D4T+DDI+NFV 31
4 D4T+DDI+EFV 70
5 D4T+DDI+NVP 61
6 3TC+ABC+DDI+TDF 62

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, N37D, L63A, V77I, I93L  
>CA34241| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       V60I, I135T, R211K, A272P  
>CA35255| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005