<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5981 CA34212 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 3TC+AZT 109
3 3TC+AZT+RTV 74
4 DDI+DLV+NFV 17
5 D4T+DLV+RTV+SQV 65
6 ABC+APV+DDI 52
7 ABC+APV+D4T+RTV 96
8 3TC+ABC+APV+RTV 17
9 3TC+ABC+APV+RTV+TDF 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, I84V, L90M L33F, L89LV L10I, I13V, K20R, E35D, M36I, N37S, R41K, I62V, L63P, A71V, P79A  
>CA34212| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVFEDISLPGKWKPKLIGGIGGFMKVRQYD
QVPIEICGHKVIGTVLVGATPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N K103NS, Y181C, G190GA   K20R, T39A, K43E, E44EA, V118I, K122P, E203K, Q207E, H208Y, R211K, K223T, L228H T253TA
>CA35226| codons 1-253
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIKELREYLWKWGFYTPDNKHQTEPPFHWMGYELHPDKWT
VQPIVLPEKDSWA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005