<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8000 CA34197 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+IDV 52
2 3TC+D4T+NFV 13
3 3TC+D4T+NVP 243
4 None 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K20R, N37D, D60E, L63X, I64V, V77I, I85V, I93L  
>CA34197| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIXVEICGHKAIGTVLIGPTPVNIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V Y181C K238KT K32KQ, D123E, I135R, K166KR, D177E, G196GE, T200TA, R211RG, F214L, H221HY, L228LR, V245E, E248Q, A272P, T286A, I293V, K366R, T369A, A376T, V381I, K390R, A400T, T403A, E404D, V435A, A437V, D460N, R461K, H483Y, L491S, S519N, W535R, A554N, I556V, K558R, V559I  
>CA35213| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIQALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYVDDLYVGSDLEIEQHRAKIEELRQHLLGWGLTTPDKKYQKEPPFRWMGYELHPDTWT
VQPIELPQKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVRQLAEAVQKITTESIIIWGKTPKFRLPIQKETWETWWADYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGVETFYVDGAANRETKLGKAGYVTNKGRQKVVSLTDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLARVPAHK
GIGGNEQVDKLVSNGVRRIL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005