<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA801 CA34192 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 52
2 3TC+D4T+RTV 13
3 3TC+D4T+IDV 54
4 D4T+DDI+RTV+SQV 24
5 3TC+AZT+NFV 21
6 DDI+EFV+Unknown 11
7 3TC+AZT+IDV+NVP+RTV 94
8 ABC+DDI+LPV 123

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L10F, G73GS T12TP, I15V, G16GA, L19LP, K20I, E35ED, M36I, N37ND, K55R, R57K, I62V, L63P, A71AV, I72IL  
>CA34192| codons 1-99
PQITLWQRPFVPIKVAGQPIEALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVRVKQYD
QVPIEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       V35I, E40F, K43E, W88WC, V118I, K122E, D123E, I135T, S162Y, Q207E, H208F, R211K, L228LH, P243PA G213GR
>CA35204| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREFLWKWRFYTPDKKHQKEPPFHWMGYELHPDKWT
VQAIVLPEKDSWTVNDIQK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005