<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14470 CA34189 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 AZT+3TC+IDV 22
3 3TC+AZT+IDV+RTV 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L33I, K43T, T74TP Q7R, L10I, K20R, M36I, K55R, I62V, L63X, I64V, I85V, L89M  
>CA34189| codons 1-99
PQITLWRRPIVTIKIGGQLREALLDTGADDTVIEEINLPGRWTPKIIGGIGGFVRVRQYD
QVXVEICGHKAIGPVLVGPTPANIVGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V       R83K, R211T  
>CA35206| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

References
Author Title Citation
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005