<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4873 CA34186 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 230
2 DDI NA
3 Unknown NA
4 3TC+ AZT+ IDV 170
5 RTV+ 3TC+ AZT+ IDV 34
6 D4T+ DDI+ LPV 128

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M V11I, L33F, G73S L10IV, T12N, L19I, M36L, N37D, K55R, I62V, L63P, C67F, A71V, I72L  
>CA34186| codons 1-99
PQITLWQRPIINIKIGGQIKEALLDTGADDTVFEELDLPGRWKPKLIGGIGGFVRVRQYD
QVPIEIFGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q K101E   P1L, E28EA, E53EG, V60VI, A98S, D123E, I135T, S162Y, V179VI, I195T, T200A, V245K, A272P, A288S, I293IV  
>CA35194| codons 1-301
LISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISKIGPGNPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLEKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLETGQHRAKIEELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005