<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4127 CA34185 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 69
2 3TC+D4T+IDV 61
3 3TC+D4T+NFV+NVP 31
4 3TC+D4T+NFV+RTV+SQV 69
5 3TC+ABC+APV 83
6 3TC+D4T+LPV 35
7 3TC+AZT 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M V11I, F53FL, Q58QE L10I, I13V, I15V, K20I, K55R, L63P, A71I, Q92QR  
>CA34185| codons 1-99
PQITLWQRPIITVKVGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLMRVREYD
QIPIEICGHKIIGTVLVGPTPVNVIGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y A62AV, V75I K103N, Y181YC   I31L, V35T, A98S, D123E, Q174QR, I178L, V179I, Q207E, R211K, L228H  
>CA35193| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTEICTELEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDLII
CQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005