<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5471 CA34175 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 78
2 3TC+AZT 39
3 3TC+AZT+IDV 39
4 D4T+DDI+RTV+SQV 56
5 D4T+DDI+IDV+RTV 104
6 D4T+DDI+EFV 39
7 ABC+APV+DDI+LPV 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76LV, V82A L10F, L24I, L33F I13IV, L19I, K55R, L63P, A71V, I93L  
>CA34175| codons 1-99
PQITLWQRPFVTVKIGGQIKEALIDTGADDTVFEEMNLPGRWKPKIIGGIGGFVRVRQYD
QIPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q K103N   K20R, V60I, K66KR, K122P, K166R, D177EK, G196E, R211RK, D218E, V245T, K277R, T286A, A288S, I293V, P294T, E297K  
>CA35186| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKRNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKSLTEVVTLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005