<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7869 CA34162 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+APV+AZT+NVP 4
2 3TC+APV+AZT 53
3 3TC+D4T+EFV+LPV 82
4 None 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, I13V, K20I, M36MI, L63P, C67F, A71V, I72IL, P79A  
>CA34162| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEIFGHKVLGTVLVGATPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DN, K70R K219Q K103KN   K20R, I202IV, R211K, F214L, L228H, E248D, A272PS  
>CA35177| codons 1-286
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGLTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005