<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4497 CA34161 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 3TC+AZT+IDV 44
3 DDC+SQV 26
4 D4T+NFV 70
5 3TC+D4T+NFV 33
6 ABC+AZT+NVP+RTV+SQV 93
7 ABC+AZT+LPV+NVP 26
8 3TC+APV+LPV+TDF 58

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, I84V L89V L10I, V11L, I13V, I15V, K20I, E35D, M36I, N37D, D60E, L63P, K70E, A71I, Q92K  
>CA34161| codons 1-99
PQITLWQRPILTVKVGGQLIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYE
QIPIEICGHEIIGTVLVGPTPTNVIGRNVLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y       K20KR, V35T, T39TA, E44ED, K102KR, K122E, I135T, K166KR, L210F, R211K, A272P, K277R, L283I, R284K, I293V  
>CA35169| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLFKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIKGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005