<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4864 CA34154 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 74
2 AZT+DDC 35
3 3TC+AZT+IDV 187
4 ABC+APV+D4T+NVP 165

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, L90M L33F, G73T, L89V L10I, L63P, K70T  
>CA34154| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFLKVRQYD
QIPIEICGHTAITTVLVGPTPVNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, L210W, T215Y K219R V106A F227L K43KE, V90VI, V118VI, K122E, D123E, I142V, S163SC, T165TI, I178L, V179I, G196E, K277R, T286A, A288T, E297K, R356K, A360T, T386I, K390R, A400T, V435L, N447NS, E449D, H483Y, L484IM, L491S, Q520H, K527Q  
>CA35168| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSATVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSCMIKILEPFRKQNPDLII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPDRKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKTLTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRGT
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPILGAETFYVDGAASRDTKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIYMALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSHIIEQLIQKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009