<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3914 CA34152 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 111
2 AZT+DDC 39
3 3TC+AZT 31
4 3TC+D4T 37
5 AZT+DDI+NFV 77
6 3TC+AZT+EFV+NFV 91
7 APV+D4T+DDI 31
8 ABC+APV+D4T+DDI+LPV 61
9 ABC+DDI+TDF 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I, T74TP L10I, R41K, I62IV, L63P, A71T, I72V, V77I, L89LM, I93L  
>CA34152| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTVGPVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, T39TA, I142V, E169ED, G196E, R211A, F214L, V245M, Q278E, I293V, E297K  
>CA35167| codons 1-300
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLAWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGTKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005