<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9430 CA34137 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 13
2 3TC+D4T+NFV 96
3 3TC+D4T+EFV+NFV 22
4 3TC+APV+AZT 187

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I50V L33F, N88D I13V, E34D, E35D, M36I, K43KQ, L63P, H69Q, A71T, V82VI, L89X  
>CA34137| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVFDDINLPGRWQPKMIGGVGGFIKVRQYD
QIPIEICGQKTIGTVLVGPTPINIIGRDXLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70R, M184V K219Q K103N   K104R, K122E, R211KM, F214L, A272P, T286TA P150PS
>CA35152| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLSQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLMWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009