<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14498 CA34129 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 22
2 3TC+AZT 39
3 3TC+AZT+SQV 9
4 3TC+AZT+IDV 135
5 3TC+AZT 109
6 None 104

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F K14KR, D60E  
>CA34129| codons 1-99
PQITLWQRPFVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35VI, K122KE, K166R, P176S, D177N, G196E, T200A, F214L, V245K, A272P, T286P, I293V, E297R  
>CA35140| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNSNIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGPKALTEVVPLTREAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005