<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14690 CA34128 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 171
2 3TC+ D4T+ RTV+ SQV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   L10I, L19V, L24F, F53Y, L63P, A71V, I72V, V77I, Q92R, I93L  
>CA34128| codons 1-99
PQITLWQRPIVTIKIGGQVKEALFDTGADDTVLEEMNLPGRWKPKIIGGIGGYIKVRQYD
QIPIEICGHKVVGTVLIGPTPVNVIGRNLMTRLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     K20R, T69E, K101Q, V118I, K122E, S162C, V179I, T200A, Q207E, R211RK, F214L, I293V, E297A  
>CA35144| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005