<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7991 CA34127 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 None 109
3 3TC+AZT 56
4 D4T+DDI+DLV 9
5 D4T+DDI+NFV 174
6 DDI+IDV+RTV 94

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, M46I, V82A L24I, N88D L10IV, I13IV, K20KT, R41K, K45KR, K55KR, L63P, A71V, I72IL, V77I, Q92QK  
>CA34127| codons 1-99
PQITLWQRPIVTVKIGGQLTEALIDTGADNTVLEEMNLPGKWKPRIIGGIGGFIRVRQYD
QIPIEICGHKVLGTVLIGPTPANIIGRDLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y D67G, K219N     E44D, S68G, V106I, V118I, K122E, D123E, I135T, S162C, I178L, V179I, I202V, V245IT, A272P, I293V  
>CA35143| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLII
YQYMDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009