<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14683 CA34118 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46ML N88D E34ED, N37S, I62V, L63P, T74TS, V77I, I93L  
>CA34118| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLDEMSLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAIGSVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219EQ     V60VI, K102KR, I142V, R211X, F214L, T286A, I293V  
>CA35135| codons 1-296
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLXWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005