<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6802 CA34090 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 104
2 3TC+DDC+SQV 13
3 3TC+DDC+IDV 21
4 NVP 43
5 3TC+AZT+NVP+SQV 56
6 AZT+3TC+NVP+SQV 17
7 ABC+DDI+EFV+IDV 17
8 None 39
9 D4T+NVP+RTV+SQV 47
10 3TC+ABC+LPV+NVP 61
11 3TC+ABC+APV+AZT+TDF 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54A, V82A   L10I, L19T, E34EQ, I62V, L63P, A71V, V77I, L90X, I93L  
>CA34090| codons 1-99
PQITLWQRPIVTIKIGGQTKEALLDTGADDTVLQEMNLPGRWKPKMIVGVGGFAKVRQYD
QVPIEICGHKVIGTVLIGPTPANIIGRNLXTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y K219R K101KE, V106A, Y181YC, G190GA V108I, F227FL K20R, V35I, K43E, E44A, V90VI, V118I, K122E, I135T, T165I, D177E, I178M, G196E, E203ED, Q207E, R211K, H221HY, A272P, K277R, T286A  
>CA35102| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLEKKKSATILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEMVI
CQYMDDLYVASDLEIEQHRTKIDELREHLWKWGFYTPDRKYQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005