<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14663 CA34083 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV+NVP 91
2 3TC+D4T+DDI 253

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, N37D, I62V, L63S, I64M, A71V, I72E, I93L  
>CA34083| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QVSMEICGHKVEGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74V, M184V, L210LW, T215F D67G, K219Q K103KN   K20R, A33AG, V60VI, S68G, K104KR, K122KE, Q174X, I178IM, G196E, Q207E, H208HY, R211K, D218E, L228LH, T286A, A288S  
>CA35109| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKGLVEICTELEKEGKISKIGPENPYNTPI
FAIKKKGGTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKXNPDMVI
YQYVDDLYVGSDLEIEQHRTKIEELREYLWKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKSLTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005