<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14242 CA34079 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+APV+DDI+EFV+RTV+SQV+TDF 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50IV, I54V, V82A, L90M L10F, L33F I13V, K20R, E35D, M36I, N37D, R41K, R57K, I62V, L63P, A71V, I85V  
>CA34079| codons 1-99
PQITLWQRPFVTVKIGGQLREALLDTGADDTVFEDIDLPGKWKPKIIGGVGGFVKVKQYD
QVPIEICGHKVIGTVLVGPTPANIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219Q K101KE, K103KN, Y181C, G190A A98G V35E, T39A, E40F, V106VI, K122E, D123N, G196E, E203K, Q207E, H208HY, K223E, L228H, A272P  
>CA35089| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAFLEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLEKNKSITVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIEQHRTKIKELREYLWRWGFYTPDQKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005