<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1435 CA34078 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 20
2 AZT+D4T 29
3 3TC+D4T 12
4 3TC+AZT+D4T+IDV 28
5 DDC+RTV+SQV 29
6 AZT+DDI+NFV 28
7 ABC+EFV+RTV+SQV 22
8 3TC+ABC+EFV+NFV 26
9 ABC+EFV+NFV 15
10 ABC+APV+EFV+NFV 11
11 ABC+APV+EFV+NFV 4
12 ABC+APV+NFV 35
13 3TC+DDI+SQV 48
14 3TC+DDI+LPV+SQV 48
15 3TC+DDI+LPV+SQV+TDF 26
16 3TC+DDI+LPV+TDF 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90M L10F, V11VI, L33F, K43PT, G73S T12S, I15V, L19Q, M36L, N37S, K55R, I62V, L63P, A71V  
>CA34078| codons 1-99
PQITLWQRPFISIKVGGQQKEALLDTGADDTIFEELSLPGRWPPKIIGGIGGFVRVRQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67HN, T69D, K70R, L74IV, M184V, T215F K219Q     V35K, T39A, V60I, K104KN, V118I, K122E, I135T, S162D, F214L, A272P, E297K  
>CA35098| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAELEKEGKISKIGPENPYNTPI
FAIKKKHSDRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009