<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14642 CA34049 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 104
2 3TC+AZT+IDV 152
3 3TC+AZT+NFV 17
4 ABC+D4T+EFV 182

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S M46MV L10I, Q18H, E35D, N37S, R41K, L63P, I72V, I93L  
>CA34049| codons 1-99
PQITLWQRPIVTIKIGGHLKEALLDTGADDTVLEDMSLPGKWKPKVIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI, M184V K219Q K103N   I31IT, K49KR, K64R, K101KQ, K122E, D177E, E203EV, R211K, F214L, D218E, L228H, V245E, I293V, E297A  
>CA35074| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKTKALVEICTEMEKEGKISRIGPENPYNTPV
FAIRKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIVELRQHLLKWGLTTPEQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005