<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4518 CA34035 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 265
2 AZT+IDV 57
3 3TC+D4T+IDV 52
4 DDI+DLV+NFV 65
5 ABC+APV+D4T+RTV 150

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54L, V82T, L90M V11I L10Y, I15V, L19IT, K20I, M36I, N37D, R41K, K45R, L63P, A71V, I85V, Q92R  
>CA34035| codons 1-99
PQITLWQRPYITIKVGGQIIEALLDTGADDTILEEIDLPGKWKPRMIGGIGGFLKVRQYD
QIPIEICGHKVIGTVLVGPTPTNIVGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y K219Q Y181C   T7A, V35T, T39A, E44D, V60I, K101Q, K103R, K122E, D123E, I135V, S162C, G196E, E203D, D218E, L228R, V245T, I293V  
>CA35048| codons 1-301
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKRKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIDELRQHLWRWGFYTPEQKHQKEPPFRWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005