<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7881 CA34009 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 55
2 3TC+AZT+DLV+NFV 16
3 ABC+DDI+LPV 68
4 D4T+DDI+LPV+TDF 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82A, L90M F53FL, Q58E, L89V L10I, I13V, L19LV, K20IM, L33L_L, M36I, I62V, L63P, A71V, Q92K  
>CA34009| codons 1-99
PQITLWQRPIVTVKIGGQVIEALLDTGADDTVLEEINLPGRWKPKIVGGIGGLVKVREYD
QVPIEICGHKVIGTVLVGPTPANIIGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M, T215F K219E K103KN, Y181YC   V35T, T69N, K122E, D123DN, I142V, I167IV, I178IM, T200A, Q207K, R211A, R284K, A288AS, I293V, L303W, E305K E302D, A304Q, N306T
>CA35021| codons 1-306
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKVLEPFRKQNPDMVI
CQYMDDLYVGSDLEIGQHRAKIEELRKHLLAWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKSLTEVVPLTEEAE
LDWQKT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005