<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1289 CA33998 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 4
2 D4T 17
3 3TC+D4T 9
4 3TC+D4T+SQV 48
5 3TC+D4T+NFV 25
6 3TC+D4T+RTV+SQV 255
7 3TC+RTV+SQV+TDF 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M V11VI, K43T, G73S L10I, I15V, K20I, N37ND, R57K, I62V, L63P, A71I, P79S  
>CA33998| codons 1-99
PQITLWQRPIITIKVGGQLIEALLDTGADDTVLEEMDLPGRWTPKMIGGIGGFLKVKQYD
QVPIEICGHKIISTVLVGSTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K20R, V35I, K43Q, V60VI, T69TN, I135V, I142IV, S162SN, K166KR, D218E, K277R, I293V, L303W E302D, A304Q
>CA35013| codons 1-304
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEQEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQNSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE
LDWQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005