<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1808 CA33978 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 143
2 DDI 169
3 D4T+3TC+IDV 61
4 3TC+AZT+DDI+IDV 8
5 AZT+3TC+NVP+NFV 78
6 ABC+EFV+RTV+SQV 22
7 ABC+APV+D4T+DDI+RTV+SQV 182

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, I84V, L90M G73C L10I, I13IM, I15V, K20I, M36I, R41K, I62V, L63P, I72L, I85V, I93L  
>CA33978| codons 1-99
PQITLWQRPIVTMKVGGQLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFLKVRQYD
QVPIEICGHKALCTVLVGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y D67G, K219N L100LI, K101KE, K103KN, Y181YC V108VI E6ED, K20R, E28EK, E44D, S68G, V118I, K122KE, I135V, S162C, T200A, D218E, D237DE, V245T, A272P, K281R, T286A  
>CA34994| codons 1-301
PISPIDTVPVKLKPGMDGPRVKQWPLTKEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIEKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPENKHQKEPPFLWMGYELHPEKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005