<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8355 CA33974 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 D4T+ 3TC+ RTV 52
3 AZT+ DDI+ IDV 52
4 RTV+ SQV+ 3TC+ D4T 104
5 ABC+ EFV+ RTV+ SQV 52
6 APV+ SQV+ EFV+ ABC 56
7 3TC+APV+D4T+LPV+TDF 82

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50V, I54V, L90M L23I, L33I, F53L, G73C L10I, K20R, E35D, M36I, I62V, L63P, I64V, I66L, A71I, I72V, I93L  
>CA33974| codons 1-99
PQITLWQRPIVTIKIGGQLREAILDTGADDTIIEDINLPGRWKPKIVGGVGGLVKVRQYD
QVPVELCGHKIVCTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74V, M184V, L210W, T215Y K219R Y181C, G190A K101H, V108I E40F, K43E, V118I, K122E, I135IT, I142IV, S162C, V179I, T200A, E203K, Q207D, H208Y, R211K, K223Q, L228R, Q242L, A272P, P294S E302D
>CA34990| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKDSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
CQYVDDLYVASDLEIGQHRAKIKELRDYLWKWGFYTPDRKHQQEPPFRWMGYELHPDKWT
VLPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVISLTEEAE
LD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005