<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1130 CA33973 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 D4T 32
3 3TC+ AZT 56
4 SQV+ RTV+ D4T+ 3TC 267
5 3TC+ ABC+ EFV+ TDF 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M L33F, G73T L10I, T12TS, I13IV, R41RK, L63P, A71V, V77I, I93L  
>CA33973| codons 1-99
PQITLWQRPIVSVKIGGQLKEALLDTGADDTVFEEMNLPGKWKPKMIGGIGGFLKVRQYD
QIPIEICGHKVITTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI, M184V K219Q K103N V108I, P225PH K64N, T69N, K122E, D123E, E169A, Q174K, D177E, I178M, T200A, Q207E, R211K, F214L, L228H, A272P A267AT
>CA34988| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAINKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILAPFRKKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDQKHQKEHPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWTSQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005