<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4401 15.ZA.WC592 South Africa 2015 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   G190A A98AG V21I, V35T, E36A, T39E, S48T, V60I, W88C, K101Q, K122E, D123G, K173A, D177G, T200A, E203K, Q207E, R211K, V245Q  
>15.ZA.WC592| codons 1-261
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPGGLQKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPGIVI
YQYVDDLYVASDLEIGQHRAKIKELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16GE, L19IV, E35ED, M36IL, N37NADT, R41RK, R57RK, Q61QE, L63T, E65ED, H69K, L89IM, I93L  
>15.ZA.WC592| codons 1-99
PQITLWQRPLVSIKVEGQVKEALLDTGADDTVLEDLALPGKWKPKMIGGIGGFIKVKQYD
EITIDICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017