<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3985 CA33970 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 AZT+DDC 86
3 3TC+AZT 30
4 3TC+AZT+SQV 13
5 3TC+D4T+RTV 17
6 D4T+DDI+IDV 26
7 AZT+DDI+NFV 17
8 NVP+AZT+DDI+NFV 13
9 DDI+RTV+SQV 30
10 D4T+DDI+RTV+SQV 13
11 D4T+DDI+NFV+SQV 18
12 Unknown 189

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L24I, Q58E L10I, T12P, I13IV, A22V, N37S, F53Y, K55R, R57K, D60E, Q61E, I62V, L63P, A71V, I72T, V77VI, I93L  
>CA33970| codons 1-99
PQITLWQRPIVPVKIGGQLKEVLIDTGADDTVLEEMSLPGRWKPKIIGGIGGYIRVKEYE
EVPIEICGHKVTGTVLIGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, L210W, T215Y D67G, K70T K103KN, Y181YC   K20KR, K32N, E44ED, S68G, K101X, V118I, K122KE, I135K, E169EA, V179VI, Y188X, G190X, R211K, E248EA, A272P, V276T, K277KR, L283I, A288T, I293V  
>CA34985| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKINALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKGGTTWRKVVDFRELNKRTQDFWEVQLGIPHPAGLXKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILAPFRKQNPDIII
CQYMDDLXVXSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPAKDSWTVNDIQKLVGKLNWASQIYPGIKTRQLCKLIRGTKTLTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005