<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
523 14.ZA.EC1036 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N V108I K20R, V35T, T39A, S48T, E53D, K101Q, K122P, S162A, K173D, Q174R, D177E, I178IL, G196K, T200A, R206S, Q207E, R211K, H221HY, V245Q  
>14.ZA.EC1036| codons 1-262
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAEMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTILDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRDRNPELVI
YQYMDDLYVGSDLEIKQHRAKIEELSEHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20R, E35D, M36I, R41K, L63V, H69K, T74S, I93L  
>14.ZA.EC1036| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017