<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14581 CA33959 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+NFV 189

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   L10I, I13V, K20R, E35D, M36I, D60E, Q61E, I62V, L63P, I72V, I93L  
>CA33959| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYE
EVPIEICGHKAVGTVLVGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, V75ST, M184V, L210LW, T215Y A62AV     K20KR, V35M, D177E, V179I, I202V, R211K, V245T, A272P, E297K  
>CA34974| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKISDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005