<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4493 15.ZA.EC1527 South Africa 2015 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115YF, M184V A62V Y181C V108I K22R, V35I, T39N, E40D, K46Q, S48T, S68N, W88WC, V90I, K101R, K122E, D123S, S162Y, S163N, K173A, D177E, V189I, T200A, I202V, Q207E  
>15.ZA.EC1527| codons 1-208
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALIEICNDMEKEGQITKIGPENPYNTPV
FVIKRKDNTKWRKLVDFRELNKRTQDFCEIQLGIPHPAGLRKKKSVTILDVGDAFFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYNMTKILEPFRAQNPEIVI
CQYVDDLYIGSDLEIGQHRAKVEELREH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F T12P, L19I, N37S, Q61E, L63P, C67H, H69K, V77I, L89M, I93L  
>15.ZA.EC1527| codons 1-99
PQITLWQRPLVPIKIGGQIKEALLDTGADDTVFEEMSLPGRWKPKMIGGIGGFIKVRQYD
EIPIEIHGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017