<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8440 CA33942 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDC+IDV 113
2 3TC+AZT+IDV 48
3 3TC+ABC+EFV 26
4 None 35
5 3TC+AZT+NFV 65
6 None 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I15V, E35D, M36V, R41K, D60E, L63P  
>CA33942| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDVNLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V A62V, V75I K103N   I31L, K49R, K122E, Q145QR, G196E, Q207E, R211K, V245M, D250E, K277KR, T286A, E297KR E302D
>CA34957| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISRIGPENPYNTPV
FVIKKKNSTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYRYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTKEAE
LD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005