<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1158 CA33933 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 42
2 AZT+DDI 10
3 3TC+AZT+IDV 44
4 AZT+IDV+NVP 9
5 3TC+AZT+NFV+SQV 35
6 None 10
7 ADV+DDI+EFV+RTV+SQV 24
8 NFV+SQV 15
9 None 14
10 3TC+ADV+AZT+EFV 25
11 None 58
12 3TC+D4T+EFV 9
13 3TC+APV+D4T+DDI+LPV 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L23I, L33F, F53L L10I, E35D, M36V, R57K, D60E, I62V, L63P, A71V, I93L  
>CA33933| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVFEDVNLPGRWKPKMIGGIGGLVKVKQYE
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N, Y188L   P1L, K43N, K122E, E138A, I142V, S162C, R211Q, L228R, V245E, K277R, Q278H, I293V, E297A  
>CA34949| codons 1-300
LISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLWQWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGTKALTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005