<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4487 CA33929 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ D4T+ 3TC 28
2 IDV+ D4T+ 3TC 234

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63S, V77VI  
>CA33929| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V K219Q     K20R, V60I, D123E, I135X, I159IV, S162SC, D177E, I202V, R211K, A272P  
>CA34944| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSXNNETPGIRYQYNVLPQGWKGSPAVFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005