<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1833 CA33923 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 D4T 87
3 3TC+AZT+IDV 42
4 3TC+D4T+IDV 26
5 DDC+NFV+NVP 47
6 DDC+RTV+SQV 31
7 ABC+EFV+RTV+SQV 38
8 APV+D4T+EFV+RTV 28
9 3TC+APV+D4T+DDI+RTV 118

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48M, I54M, V82A, I84V L33F L10I, T12P, L19V, L63T, A71V, I72T, T74A, I93L L23LV
>CA33923| codons 1-99
PQITLWQRPIVPIKIGGQVKEAVLDTGADDTVFEEMNLPGRWKPKLIMGIGGFMKVRQYD
QITIEICGHKVTGAVLVGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, M184V, L210W, T215Y V75VA K101EQ, Y181C, G190A A98G, V108I K20R, T39E, E44D, V118I, K122E, I135T, T165TI, R172RK, G196E, E203K, H208Y, R211K, H221Y, A272S, V276T, K277R, Q278E, L283I, I293V, E297K  
>CA34938| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICEELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKIADFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFKKQNPDIVI
CQYVDDLYVASDLEIEQHRTKIKELRQYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKTRELCKLIRGTKALTEVVPLTKEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005