<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4391 CA33921 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 74
2 EFV+AZT+D4T 27
3 D4T+DDI+RTV+SQV 127

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, I84IV, L90LM F53L, N88D I13V, K20R, E35D, M36I, R57K, Q61E, L63P, A71AV  
>CA33921| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADNTVLEDINLPGRWKPKMIGGIGGLIKVKQYD
EIPIEICGHKVIGTVLVGPTPVNVIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DGNS, K70R   L100LI, K103N, V106VA   V245L, A272P  
>CA34936| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKSSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005