<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4743 CA33906 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC 78
2 3TC+D4T+IDV 126
3 3TC+D4T+IDV+RTV 26
4 3TC+D4T+NFV 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M L10FI, K43T L19I, N37NS, K55R, L63P, H69Q, A71V, I72IV  
>CA33906| codons 1-99
PQITLWQRPFVTIKIGGQIKEALLDTGADDTILEEMSLPGRWTPKIIGGIGGFIRVRQYD
QIPIEICGQKVVGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, K70R, M184V, T215F D67G     T7TA, K20KR, T39TA, S68G, I135T, S162Y, Q174H, I178IM, Q207E, L228LHQ, A272P, A288S, E297K, G333E, R356K, A360T, A376S, T386I, K390R, A400T, N418S, K431N, V435A, L469I, T470P, H483Y, L491S, I506L, S519N, E529D, K530R, V531I, I556V  
>CA34921| codons 1-560
PISPIEAVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKGGDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKHNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFFTPDKKHQKEPPFQWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYAKMRGT
HTNDVKQLTEAVQKISTESIVIWGKIPKFRLPIQKETWETWWTEYWQATWIPEWEFVSTP
PLVKLWYQLENEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSIPDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGILQAQPDKSESELVNQIIEQLIKKDRIYLAWVPAHK
GIGGNEQVDKLVSAGVRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005